Proteintech, 68150-1-Ig, NDUFV2 Monoclonal antibody

Size: 20ul / 150ul The NDUFV2 (68150-1-Ig) by Proteintech is a Monoclonal antibody targeting NDUFV2 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat, Rabbit, Pig, Chicken samples 68150-1-Ig targets NDUFV2 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit, Pig, Chicken samples. Tested Applications Positive WB detected in: Jurkat cells, chicken heart tissue, HeLa cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information The NDUFV2 gene encodes the 24-kD subunit of the mitochondrial NADH: ubiquinone oxidoreductase (complex I of the respiratory chain). The protein belongs to the complex I 24 kDa subunit family. It is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. NDUFV2 constitutes one genetic risk factor for PD, and the mutation may well be a cause of complex I deficiency in this disease(PMID:9570948). Specification Tested Reactivity: Human, Mouse, Rat, Rabbit, Pig, Chicken Cited Reactivity: rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7760 Product name: Recombinant human NDUFV2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-249 aa of BC001632 Sequence: MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 24-27 kDa GenBank Accession Number: BC001632 Gene Symbol: NDUFV2 Gene ID (NCBI): 4729 RRID: AB_2923674 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P19404 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.