Proteintech, 68172-1-Ig, TMEM175 Monoclonal antibody

Size: 20ul / 150ul The TMEM175 (68172-1-Ig) by Proteintech is a Monoclonal antibody targeting TMEM175 in WB, IP, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68172-1-Ig targets TMEM175 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: LNCaP cells, pig liver tissue, rabbit liver tissue, HepG2 cells, mouse brain tissue, rat liver tissue, HeLa cells, HEK-293 cells, Jurkat cells Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information TMEM175 has two repeats of 6-transmembrane-spanning segments and has no GYG K+ channel sequence signature-containing, pore-forming P loop. Lysosomes lacking TMEM175 exhibit no K+conductance, have a markedly depolarized ΔΨ and little sensitivity to changes in [K+], and have compromised luminal pH stability and abnormal fusion with autophagosomes during autophagy. TMEM175 comprises a K+ channel that underlies the molecular mechanism of lysosomal K+ permeability. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13890 Product name: Recombinant human TMEM175 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 222-313 aa of BC005158 Sequence: YVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAY Predict reactive species Full Name: transmembrane protein 175 Calculated Molecular Weight: 504 aa, 56 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC005158 Gene Symbol: TMEM175 Gene ID (NCBI): 84286 RRID: AB_2923687 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BSA9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.