Proteintech, 68191-1-Ig, GNAQ Monoclonal antibody

Size: 20ul / 150ul The GNAQ (68191-1-Ig) by Proteintech is a Monoclonal antibody targeting GNAQ in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68191-1-Ig targets GNAQ in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, rat brain tissue, pig cerebellum tissue, rat cerebellum tissue, MCF-7 cells, pig brain tissue, rabbit brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information GNAQ is a proto-oncogene closely related to the α subunit of guanine nucleotide-binding proteins (G proteins) that serve as key intermediates between membrane-bound G-protein-coupled receptors (GPCRs) and GPCR signalling nodes. Aberrant expression and activity of G proteins and GPCRs are frequently associated with tumorigenesis. Recent studies show that oncogenic activating mutations in GNAQ are present in 80% of the melanomas. The calculated molecular weight of GNAQ is 42 kDa. This antibody can detect a band of 38-40 kDa in SDS-PAGE. (PMID: 33993733) Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26178 Product name: Recombinant human GNAQ protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 84-205 aa of BC057777 Sequence: FTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVD Predict reactive species Full Name: guanine nucleotide binding protein (G protein), q polypeptide Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC057777 Gene Symbol: GNAQ Gene ID (NCBI): 2776 RRID: AB_2935280 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P50148 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.