Iright
BRAND / VENDOR: Proteintech

Proteintech, 68196-1-Ig, PHF5A Monoclonal antibody

CATALOG NUMBER: 68196-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PHF5A (68196-1-Ig) by Proteintech is a Monoclonal antibody targeting PHF5A in WB, ELISA applications with reactivity to Human, mouse samples 68196-1-Ig targets PHF5A in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, NIH/3T3 cells, HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The PHD finger-like domain protein 5a (PHF5A) is ubiquitously expressed and is located in the nucleus. The gene Phf5a and its human counterpart PHF5A (former name Ini) are located on rat chromosome 7 (RNO7q34) and human chromosome 22 (HSA2213q2), respectively. The rat gene consists of four exons, while the human gene have five exons. Both genes encode a highly conserved protein of 110 amino acids that contains a PHD finger domain.(PMID: 23675859) It acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha and is involved in pre-mRNA splicing. Specification Tested Reactivity: Human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7804 Product name: Recombinant human INI-1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-110 aa of BC007321 Sequence: MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR Predict reactive species Full Name: PHD finger protein 5A Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC007321 Gene Symbol: PHF5A Gene ID (NCBI): 84844 RRID: AB_2935285 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q7RTV0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924