Iright
BRAND / VENDOR: Proteintech

Proteintech, 68197-1-Ig, VPS25 Monoclonal antibody

CATALOG NUMBER: 68197-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VPS25 (68197-1-Ig) by Proteintech is a Monoclonal antibody targeting VPS25 in WB, IF/ICC, ELISA applications with reactivity to Human, Rabbit samples 68197-1-Ig targets VPS25 in WB, IF/ICC, ELISA applications and shows reactivity with Human, Rabbit samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, rabbit kidney tissue, HepG2 cells, Jurkat cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information VPS25 is a component of the endosome-associated complex ESCRT-II (Endosomal Sorting Complexes Required for Transport protein II). ESCRT-II complex, composed of VPS25, VPS36, and SNF8, functions in sorting of ubiquitinated membrane proteins during endocytosis. ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. VPS25 is highly conserved. Human VPS25 gene maps to chromosome 17q21.31 and is expressed in a wide range of tissues (PMID: 16889659). Specification Tested Reactivity: Human, Rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8243 Product name: Recombinant human VPS25 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-176 aa of BC006282 Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF Predict reactive species Full Name: vacuolar protein sorting 25 homolog (S. cerevisiae) Calculated Molecular Weight: 176 aa, 21 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC006282 Gene Symbol: VPS25 Gene ID (NCBI): 84313 RRID: AB_2935286 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BRG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924