Proteintech, 68223-1-Ig, ACTN2 Monoclonal antibody

Size: 20ul / 150ul The ACTN2 (68223-1-Ig) by Proteintech is a Monoclonal antibody targeting ACTN2 in WB, ELISA applications with reactivity to Human, mouse, rat, pig, rabbit samples 68223-1-Ig targets ACTN2 in WB, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig heart tissue, rat colon tissue, rabbit heart tissue, rat heart tissue, mouse heart tissue, pig colon tissue Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Background Information Alpha actinin 2 (ACTN2) belongs to the alpha-actinin family and is expressed in both skeletal and cardiac muscles and functions to anchor myofibrillar actin thin filaments and titin to Z-discs (PMID: 30701273). ACTN2 is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. Mutations in ACTN2 are associated with hypertrophic cardiomyopathy, as well as dilated cardiomyopathy and endocardial fibroelastosis (PMID: 20022194, 14567970). Specification Tested Reactivity: Human, mouse, rat, pig, rabbit Cited Reactivity: mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5578 Product name: Recombinant human ACTN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-301 aa of BC051770 Sequence: MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTI Predict reactive species Full Name: actinin, alpha 2 Calculated Molecular Weight: 104 kDa Observed Molecular Weight: 103 kDa GenBank Accession Number: BC051770 Gene Symbol: ACTN2 Gene ID (NCBI): 88 RRID: AB_2935311 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35609 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.