Proteintech, 68227-1-Ig, FABP1 Monoclonal antibody

Size: 20ul / 150ul The FABP1 (68227-1-Ig) by Proteintech is a Monoclonal antibody targeting FABP1 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples 68227-1-Ig targets FABP1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: rat liver tissue, pig liver tissue, mouse liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue, mouse brain tissue Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information FABP1, liver fatty acid-binding protein, is abundant in cytoplasm that regulates lipid transport and metabolism. It plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PMID:25732850). FABP1 is mainly expressed in hepatocytes, enterocytes and to a lesser degree in renal tubular cells, associated with liver injury (PMID: 15653098). Levels of FABP1 was elevated in patients with hepatocyte injury secondary to alcohol or drug toxicity (PMID: 14563446). Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag32836 Product name: Recombinant human FABP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-127 aa of BC032801 Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Predict reactive species Full Name: fatty acid binding protein 1, liver Calculated Molecular Weight: 127 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC032801 Gene Symbol: FABP1 Gene ID (NCBI): 2168 RRID: AB_2935315 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P07148 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.