Iright
BRAND / VENDOR: Proteintech

Proteintech, 68242-1-Ig, GLO1 Monoclonal antibody

CATALOG NUMBER: 68242-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLO1 (68242-1-Ig) by Proteintech is a Monoclonal antibody targeting GLO1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 68242-1-Ig targets GLO1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, LNCaP cells, Jurkat cells, HepG2 cells, K-562 cells, HSC-T6 cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Glo1 (glyxoalase I) is a cytosolic protein expressed in all mammalian cells. Its physiological function is the detoxification of MG (methylglyoxal), which is a potent precursor of AGEs (advanced glycation end-products). Glo1 is known to play a role in many diseases including diabetes mellitus, Alzheimer's disease, and cancer. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7314 Product name: Recombinant human GLO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-184 aa of BC001741 Sequence: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM Predict reactive species Full Name: glyoxalase I Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21-25 kDa GenBank Accession Number: BC001741 Gene Symbol: GLO1 Gene ID (NCBI): 2739 RRID: AB_2935329 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q04760 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924