Proteintech, 68247-1-Ig, KLK8 Monoclonal antibody

Size: 20ul / 150ul The KLK8 (68247-1-Ig) by Proteintech is a Monoclonal antibody targeting KLK8 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 68247-1-Ig targets KLK8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, A431 cells, EC109 cells, MOLT-4 cells, NK-92 cells Positive IHC detected in: human cervical cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information KLK8(Kallikrein-8) is also named as NRPN, PRSS19, TADG14.It is a new member of the human kallikrein family, which is predicted to be secreted and expected to be present in biological fluids (PMID:12507964).The protein is detectable in ovarian cancer tissue extracts, serum, and ascites fluid, indicating that it may serve as a new ovarian cancer marker (PMID:12782581). KLK8 has one predicted glycosylation site (PMID:20940292) and it has some isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5642 Product name: Recombinant human KLK8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-260 aa of BC040887 Sequence: MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG Predict reactive species Full Name: kallikrein-related peptidase 8 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC040887 Gene Symbol: KLK8 Gene ID (NCBI): 11202 RRID: AB_2935333 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60259 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.