Iright
BRAND / VENDOR: Proteintech

Proteintech, 68255-1-Ig, SNX9 Monoclonal antibody

CATALOG NUMBER: 68255-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SNX9 (68255-1-Ig) by Proteintech is a Monoclonal antibody targeting SNX9 in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 68255-1-Ig targets SNX9 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX9 (Sorting nexin-9, also known as SH3PX1) was originally identified as a protein that interacted with the metalloproteinases ADAM9 and ADAM15. It contains a PX and an Sec homology 3 (SH3) domain. SNX9 functions in clathrin-mediated endocytosis and clathrin-independent, actin-dependent fluid-phase endocytosis (PMID: 17609109). On SDS-PAGE, SNX9 migrates at a molecular weight (70-78 kDa) higher than its calculated molecular mass of 67 kDa (PMID: 15299020; 12952949; 18411244; 15703209). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8446 Product name: Recombinant human SNX9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-362 aa of BC005022 Sequence: MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAHASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEW Predict reactive species Full Name: sorting nexin 9 Calculated Molecular Weight: 595 aa, 67 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC005022 Gene Symbol: SNX9 Gene ID (NCBI): 51429 RRID: AB_2935340 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y5X1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924