Iright
BRAND / VENDOR: Proteintech

Proteintech, 68308-1-Ig, MOCS2B Monoclonal antibody

CATALOG NUMBER: 68308-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MOCS2B (68308-1-Ig) by Proteintech is a Monoclonal antibody targeting MOCS2B in WB, IF/ICC, ELISA applications with reactivity to human samples 68308-1-Ig targets MOCS2B in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, LNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MOCS2(Molybdenum cofactor synthesis 2) is a heterotetrameric synthase comprised of 2 small (MOCS2A) and 2 large (MOCS2B) subunits. MOCS2 acts as a sulfur carrier required for molybdopterin biosynthesis. The two MOCS2 proteins A and B are subunits of molybdopterin synthase incorporating sulfur groups delivered by the MOCS3 sulfurylase. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6282 Product name: Recombinant human MOCS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-188 aa of BC046097 Sequence: MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS Predict reactive species Full Name: molybdenum cofactor synthesis 2 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC046097 Gene Symbol: MOCS2 Gene ID (NCBI): 4338 RRID: AB_2935387 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O96007 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924