Iright
BRAND / VENDOR: Proteintech

Proteintech, 68322-1-Ig, NAB2 Monoclonal antibody

CATALOG NUMBER: 68322-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NAB2 (68322-1-Ig) by Proteintech is a Monoclonal antibody targeting NAB2 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 68322-1-Ig targets NAB2 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HEK-293 cells, U2OS cells, HSC-T6 cells, NIH/3T3 cells, HeLa cells, A2780 cells, A375 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NGFI-A-Binding protein 2 (NAB2) is a member of the poly(A)-binding protein (PABP) family in S. cerevisiae and emerged as a key component in the tightly intertwined system of poly(A) tail length control, mRNP formation, and export of mature mRNPs. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6346 Product name: Recombinant human NAB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-320 aa of BC065931 Sequence: MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSPPFSPPAGGGVPEGTGAGGLAAGGTGGGPDRLEPEMVRMVVESVERIFRSFPRGDAGEVTSLLKLNKKLARSVGHIFEMDDNDSQKEEEIRKYSIIYGRFDSKRREGKQLSLHEL Predict reactive species Full Name: NGFI-A binding protein 2 (EGR1 binding protein 2) Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC065931 Gene Symbol: NAB2 Gene ID (NCBI): 4665 RRID: AB_3085056 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15742 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924