Iright
BRAND / VENDOR: Proteintech

Proteintech, 68328-1-Ig, SH3BP1 Monoclonal antibody

CATALOG NUMBER: 68328-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SH3BP1 (68328-1-Ig) by Proteintech is a Monoclonal antibody targeting SH3BP1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 68328-1-Ig targets SH3BP1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HSC-T6 cells, LNCaP cells, HepG2 cells, Jurkat cells, NIH/3T3 cells, 4T1 cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SH3BP1 is also named as Chimeric SH3BP1-PDXP protein and BARGIN, and belongs to the to the RhoGAP family. SH3BP1 can be as a partner of the exocyst complex and establish a physical and functional link between two motility-driving pathways, the Ral/exocyst and Rac signaling pathways. (PMID:21658605). SH3BP1 localizes together with the exocyst to the leading edge of motile cells and that SH3BP1 regulates cell migration via its GAP activity upon Rac1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15165 Product name: Recombinant human SH3BP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC008282 Sequence: MAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLERDVLQPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGGSPGSHSHTTMANKVETLKEEEEELKRKVEQCRDEYLADLYHFVTKEDSYANYFIRLLEIQADYHRRSLSSLDTALAELRENHGQADHSPSMTATHFPRVYGVSLATHLQELGREIALPIEACVMMLLSEGMKEEGLFRLAAGASVLKRLKQTMASDPHSLEEFCSDPHAVAGALKSYLRELPEPLMTFDLYDDWMRAASLKEPGARLQALQEVCSRLPPENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPN Predict reactive species Full Name: SH3-domain binding protein 1 Calculated Molecular Weight: 701 aa, 76 kDa Observed Molecular Weight: 76-80 kDa GenBank Accession Number: BC008282 Gene Symbol: SH3BP1 Gene ID (NCBI): 23616 RRID: AB_2935400 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y3L3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924