Iright
BRAND / VENDOR: Proteintech

Proteintech, 68342-1-Ig, RABL3 Monoclonal antibody

CATALOG NUMBER: 68342-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RABL3 (68342-1-Ig) by Proteintech is a Monoclonal antibody targeting RABL3 in WB, IF/ICC, ELISA applications with reactivity to human samples 68342-1-Ig targets RABL3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information The gene of Rabl3 is located on 3q13.3 and is composed of eight exons and seven introns. It is a member of the Rab subfamily, the largest group in the Ras superfamily of small guanosine triphosphatases (GTPases). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33137 Product name: Recombinant human RABL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-236 aa of BC020832 Sequence: MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTCYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTTTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYD Predict reactive species Full Name: RAB, member of RAS oncogene family-like 3 Calculated Molecular Weight: 236 aa, 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC020832 Gene Symbol: RABL3 Gene ID (NCBI): 285282 RRID: AB_3085066 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q5HYI8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924