Proteintech, 68344-1-Ig, SMNDC1 Monoclonal antibody

Size: 20ul / 150ul The SMNDC1 (68344-1-Ig) by Proteintech is a Monoclonal antibody targeting SMNDC1 in WB, FC (Intra), ELISA applications with reactivity to human samples 68344-1-Ig targets SMNDC1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, Daudi cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information Survival motor neuron domain-containing protein 1 (SMNDC1), also known as survival of motor neuron-related-splicing factor 30 (SPF30) or SMN-related protein (SMNR), is a constituent of the spliceosome complex that plays an essential role in spliceosome assembly by recruiting U4/U5/U6 tri-snRNP to the pre-spliceosomal complex (PMID: 9817934; 11331595; 30904945). Both SMNDC1 and SMN1 contain a highly conserved central Tudor domain which functions as a protein-protein interaction surface and mediates binding to the spliceosomal Sm proteins (PMID: 11331595). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33140 Product name: Recombinant human SMNDC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-238 aa of BC011234 Sequence: MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ Predict reactive species Full Name: survival motor neuron domain containing 1 Calculated Molecular Weight: 238 aa, 27 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC011234 Gene Symbol: SMNDC1 Gene ID (NCBI): 10285 RRID: AB_3085068 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75940 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.