Proteintech, 68354-1-Ig, CRYBA2 Monoclonal antibody

Size: 20ul / 150ul The CRYBA2 (68354-1-Ig) by Proteintech is a Monoclonal antibody targeting CRYBA2 in WB, ELISA applications with reactivity to Human, mouse, rat samples 68354-1-Ig targets CRYBA2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: rat eye tissue, mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CRYBA2, also named as Beta A2 crystallin, is a member of crystallin superfamily. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also defined as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Crystallins are the dominant structural components of the vertebrate eye lens. The MW of this protein is 22 kDa, and this antibody specially recognises the 22 kDa protein. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8244 Product name: Recombinant human CRYBA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-197 aa of BC006285 Sequence: MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFILEKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDVGSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH Predict reactive species Full Name: crystallin, beta A2 Calculated Molecular Weight: 197 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC006285 Gene Symbol: CRYBA2 Gene ID (NCBI): 1412 RRID: AB_3085076 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P53672 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.