Iright
BRAND / VENDOR: Proteintech

Proteintech, 68374-1-Ig, ESYT2 Monoclonal antibody

CATALOG NUMBER: 68374-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ESYT2 (68374-1-Ig) by Proteintech is a Monoclonal antibody targeting ESYT2 in WB, IF/ICC, ELISA applications with reactivity to human samples 68374-1-Ig targets ESYT2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, U2OS cells, LNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells, HL-60 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ESYT2, also named FAM62B, is one of the three-member family of Extended Synaptotagmins that were recently shown to be implicated in the formation of endoplasmic reticulum (ER)-plasma membrane (PM) junctions and in the Ca(2+) dependent regulation of these junctions. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20440 Product name: Recombinant human FAM62B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 559-773 aa of BC013957 Sequence: NPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDLGRSSSSLLASPGHISVKEPTPSIASDISLPIATQELRQRL Predict reactive species Full Name: family with sequence similarity 62 (C2 domain containing) member B Calculated Molecular Weight: 921 aa, 102 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: BC013957 Gene Symbol: ESYT2 Gene ID (NCBI): 57488 RRID: AB_3085093 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: A0FGR8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924