Iright
BRAND / VENDOR: Proteintech

Proteintech, 68397-1-Ig, ATPBD4 Monoclonal antibody

CATALOG NUMBER: 68397-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATPBD4 (68397-1-Ig) by Proteintech is a Monoclonal antibody targeting ATPBD4 in WB, ELISA applications with reactivity to Human samples 68397-1-Ig targets ATPBD4 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, K-562 cells, LNCaP cells, HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Diphthamide is a highly modified histidine in the transcription factor EEF2 that is conserved from yeast to human. ATPBD4, also known as DPH6, belongs to the Diphthine--ammonia ligase family. DPH6 amidase may catalyze the last step of diphthamide biosynthesis using ammonium and ATP to play a role in catalyzing the final step of diphthamide biosynthesis, amidation of diphthine to diphthamide (PubMed:23169644). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33218 Product name: Recombinant human ATPBD4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-259 aa of BC008485 Sequence: GGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCEGDEVEDLYELLKLVKEKEEVEGISVGAILSDYQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDKVSSVPDNYRTSNYIYNF Predict reactive species Full Name: ATP binding domain 4 Calculated Molecular Weight: 267 aa, 30 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC008485 Gene Symbol: ATPBD4 Gene ID (NCBI): 89978 RRID: AB_3085114 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q7L8W6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924