Iright
BRAND / VENDOR: Proteintech

Proteintech, 68400-1-Ig, METTL6 Monoclonal antibody

CATALOG NUMBER: 68400-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The METTL6 (68400-1-Ig) by Proteintech is a Monoclonal antibody targeting METTL6 in WB, IHC, ELISA applications with reactivity to human samples 68400-1-Ig targets METTL6 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, LNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells Positive IHC detected in: human breast cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Methyltransferase-like protein 6 (METTL6) belongs to the METL family. METTL6 is as a crucial regulator of tumor cell growth, and METTL6 is a bona fide transfer RNA (tRNA) methyltransferase, catalyzing the formation of 3-methylcytidine at C32 of specific serine tRNA isoacceptors (PMID:32923617). METTL6 is a member of the RNA methyltransferase family that has been identified in many cancers. The mRNA expression levels of METTL6 were significantly upregulated in HCC tumor tissues compared to that in adjacent non tumor tissues. CRISPR/Cas9 mediated knockout of METTL6 in hepatocellular carcinoma cell lines remarkably inhibited colony formation, cell proliferation, cell migration, cell invasion and cell attachment ability (PMID:34913069). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9714 Product name: Recombinant human METTL6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-250 aa of BC022400 Sequence: MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVN Predict reactive species Full Name: methyltransferase like 6 Calculated Molecular Weight: 255 aa, 30 kDa Observed Molecular Weight: 30-32 kDa GenBank Accession Number: BC022400 Gene Symbol: METTL6 Gene ID (NCBI): 131965 RRID: AB_3085117 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8TCB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924