Proteintech, 68405-1-Ig, GATC Monoclonal antibody

Size: 20ul / 150ul The GATC (68405-1-Ig) by Proteintech is a Monoclonal antibody targeting GATC in WB, IF/ICC, ELISA applications with reactivity to human samples 68405-1-Ig targets GATC in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, A549 cells, HEK-293 cells, K-562 cells Positive IF/ICC detected in: HEK-293 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information GATC encodes a subunit of the glutamyl-tRNA(Gln) amidotransferase protein complex (GatCAB), which plays a role in aminoacylation of mitochondrial glutaminyl mt-tRNA. The complex plays an role in mitochondrial translation and protein synthesis (PubMed: 30283131). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19857 Product name: Recombinant human GATC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-136 aa of BC107145 Sequence: MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS Predict reactive species Full Name: glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial) Calculated Molecular Weight: 136 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC107145 Gene Symbol: GATC Gene ID (NCBI): 283459 RRID: AB_3085122 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43716 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.