Proteintech, 68413-1-Ig, PMS1 Monoclonal antibody

Size: 20ul / 150ul The PMS1 (68413-1-Ig) by Proteintech is a Monoclonal antibody targeting PMS1 in WB, IF/ICC, ELISA applications with reactivity to Human samples 68413-1-Ig targets PMS1 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Caco-2 cells, HeLa cells, HepG2 cells, LNCaP cells, HEK-293 cells, MOLT-4 cells, K-562 cells, HL-60 cells, Jurkat cells Positive IF/ICC detected in: Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information PMS1 Homolog 1 is a member of the DNA mismatch repair enzymes (MMREs) which is to eliminate the mismatch of insertions and deletions as a consequence of DNA polymerase errors at DNA synthesis in eukaryotes. PMS1 and MLH1 could form a heterodimer MutLβ that belongs to MMREs (PMID:25619773). In the MMR system, the MutS complex recognizes the DNA mispairs firstly, and then the Mlh1-Pms1 and other associated proteins such as PCNA, RFC, ExoI were recruited, inducing Exonuclease 1 (Exo1)-dependent and -independent MMR pathways (PMID:24981171). Mutations in this gene cause hereditary nonpolyposis colorectal cancer(HNPCC), which is also known as Lynch syndrome. It was reported that PMS1 is a widely expressed protein and located in the nucleus. Alternative splicing allows for 4 isoforms of PMS1 protein. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28127 Product name: Recombinant human PMS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 340-616 aa of BC096331 Sequence: LPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEE Predict reactive species Full Name: PMS1 postmeiotic segregation increased 1 (S. cerevisiae) Observed Molecular Weight: 106 kDa GenBank Accession Number: BC096331 Gene Symbol: PMS1 Gene ID (NCBI): 5378 RRID: AB_3085129 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P54277 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.