Proteintech, 68417-1-Ig, MPI Monoclonal antibody

Size: 20ul / 150ul The MPI (68417-1-Ig) by Proteintech is a Monoclonal antibody targeting MPI in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig samples 68417-1-Ig targets MPI in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: MCF-7 cells, HEK-293 cells, rat brain tissue, A549 cells, LnCaP cells, Jurkat cells, K-562 cells, pig brain tissue Positive IP detected in: Jurkat cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information MPI(mannose-6-phosphate isomerase) is also named as PMI1 and belongs to the mannose-6-phosphate isomerase type 1 family. It is a zinc metalloenzyme that catalyzes the reversible isomerization of mannose-6-phosphate and fructose-6-phosphate. MPI plays a critical role in maintaining the supply of D-mannose derivatives, which are required for most glycosylation reactions. This proterin has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5475 Product name: Recombinant human MPI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-423 aa of BC046357 Sequence: MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL Predict reactive species Full Name: mannose phosphate isomerase Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 40-47 kDa GenBank Accession Number: BC046357 Gene Symbol: MPI Gene ID (NCBI): 4351 RRID: AB_3085132 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P34949 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.