Iright
BRAND / VENDOR: Proteintech

Proteintech, 68426-1-Ig, ZNF174 Monoclonal antibody

CATALOG NUMBER: 68426-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF174 (68426-1-Ig) by Proteintech is a Monoclonal antibody targeting ZNF174 in WB, ELISA applications with reactivity to Human, mouse, rat, rabbit samples 68426-1-Ig targets ZNF174 in WB, ELISA applications and shows reactivity with Human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: BxPC-3 cells, HeLa cells, HepG2 cells, Daudi cells, rabbit testis tissue, rat testis tissue, mouse testis tissue, rat ovary tissue, mouse ovary tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: Human, mouse, rat, rabbit Host / Isotype: Mouse / IgG3 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12967 Product name: Recombinant human ZNF174 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-234 aa of BC000876 Sequence: MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTELLIEKTDPNMATDELPCKLWLSFIA Predict reactive species Full Name: zinc finger protein 174 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC000876 Gene Symbol: ZNF174 Gene ID (NCBI): 7727 RRID: AB_3085140 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15697 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924