Iright
BRAND / VENDOR: Proteintech

Proteintech, 68427-1-Ig, HERPUD2 Monoclonal antibody

CATALOG NUMBER: 68427-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HERPUD2 (68427-1-Ig) by Proteintech is a Monoclonal antibody targeting HERPUD2 in WB, IF/ICC, ELISA applications with reactivity to Human samples 68427-1-Ig targets HERPUD2 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: NCI-H1299 cells, L02 clls, HepG2 cells, A549 cells, HT-29 cells, LNCaP cells, K-562 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HERPUD2, also named as Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein, is a 406 amino acid protein, which contains one ubiquitin-like domain. HERPUD2 as a single-pass membrane protein could be involved in the unfolded protein response (UPR) pathway. HERPUD2 may exstis as two isoforms 406aa,45 kDa and 297aa 33 kDa (Genebank:EAW94050). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG3 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15007 Product name: Recombinant human HERPUD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-200 aa of BC005091 Sequence: MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTNRESHEALTSSSNSSSDHSGSTTPSSGQETLSLAVGSSSEGLRQRTLPQAQTDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAH Predict reactive species Full Name: HERPUD family member 2 Calculated Molecular Weight: 406 aa, 45 kDa Observed Molecular Weight: 35-45 kDa GenBank Accession Number: BC005091 Gene Symbol: HERPUD2 Gene ID (NCBI): 64224 RRID: AB_3085141 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BSE4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924