Proteintech, 68435-1-Ig, BHLHE40 Monoclonal antibody

Size: 20ul / 150ul The BHLHE40 (68435-1-Ig) by Proteintech is a Monoclonal antibody targeting BHLHE40 in WB, ELISA applications with reactivity to Human samples 68435-1-Ig targets BHLHE40 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Calu-3 cells, A549 cells, HCT 116 cells, MDA-MB-468 cells, Saos-2 cells, HeLa cells, PC-3 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information BHLHE40 (Basic Helix-Loop-Helix Family Member E40), also known as BHLHB2, STRA13, DEC1, or SHARP2, is a member of the basic helix-loop-helix (bHLH) protein family, a large superfamily of transcriptional regulators expressed in many organisms. BHLHE40 is known to regulate a wide variety of essential cellular processes, including cell cycle, cellular proliferation, programmed cell death, cellular development and differentiation, as well as circadian rhythms (PMID: 34551158). It is reported that BHLHE40 is overexpressed in gastric, breast, and brain tumors; and downregulated in colorectal, esophageal, pancreatic and lung cancer (PMID: 32577154). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12236 Product name: Recombinant human BHLHE40 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-412 aa of BC082238 Sequence: MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD Predict reactive species Full Name: basic helix-loop-helix family, member e40 Calculated Molecular Weight: 412 aa, 46 kDa Observed Molecular Weight: 46-50 kDa GenBank Accession Number: BC082238 Gene Symbol: BHLHE40 Gene ID (NCBI): 8553 RRID: AB_3085148 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14503 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.