Iright
BRAND / VENDOR: Proteintech

Proteintech, 68437-1-Ig, HDAC5 Monoclonal antibody

CATALOG NUMBER: 68437-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HDAC5 (68437-1-Ig) by Proteintech is a Monoclonal antibody targeting HDAC5 in WB, ELISA applications with reactivity to Human, mouse, rat samples 68437-1-Ig targets HDAC5 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: Saos-2 cells, COLO 320 cells, HeLa cells, T-47D cells, SK-BR-3 cells, A2780 cells, HepG2 cells, HSC-T6 cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Histone acetylation and deacetylation alternately exposes and occludes DNA to transcription factors. At least 4 classes of HDAC were identified. HDAC5 is a class II HDAC. HDAC5 responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. HDAC5 is involved in muscle maturation by repressing transcription of myocyte enhancer MEF2C. During muscle differentiation, HDAC5 shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30557 Product name: Recombinant human HDAC5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 371-513 aa of NM_005474 Sequence: NISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVM Predict reactive species Full Name: histone deacetylase 5 Calculated Molecular Weight: 122 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: NM_005474 Gene Symbol: HDAC5 Gene ID (NCBI): 10014 RRID: AB_3085150 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UQL6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924