Proteintech, 68438-1-Ig, BIK Monoclonal antibody

Size: 20ul / 150ul The BIK (68438-1-Ig) by Proteintech is a Monoclonal antibody targeting BIK in WB, ELISA applications with reactivity to Human samples 68438-1-Ig targets BIK in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: SW480 cells, Caco-2 cells, THP-1 cells, Raji cells, Daudi cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information The protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and viral survival-promoting proteins. Since the activity of this protein is suppressed in the presence of survival-promoting proteins, it is suggested as a likely target for anti-apoptotic proteins. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6353 Product name: Recombinant human BIK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-134 aa of BC001599 Sequence: MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCE Predict reactive species Full Name: BCL2-interacting killer (apoptosis-inducing) Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC001599 Gene Symbol: BIK Gene ID (NCBI): 638 RRID: AB_3085151 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13323 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.