Iright
BRAND / VENDOR: Proteintech

Proteintech, 68465-1-Ig, STEAP4 Monoclonal antibody

CATALOG NUMBER: 68465-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STEAP4 (68465-1-Ig) by Proteintech is a Monoclonal antibody targeting STEAP4 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 68465-1-Ig targets STEAP4 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, rat liver tissue, HaCaT cells, HeLa cells, MDA-MB-468 cells, SK-BR-3 cells, mouse liver tissue Positive FC (Intra) detected in: 3T3-L1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information STEAP4 (also called STAMP2), is a member of the STEAP family. Structurally, It is a 459 amino acid protein characterized by a molecular topology of six transmembrane domains. The cytoplasmic N-terminal domain of STEAP4 shows structural similarity with bacterial and archaeal FNO oxidoreductase and STEAP4 exhibits a strong iron reductase activity. Studies in mice and human suggest that STEAP4 maybe involved in adipocyte development and metabolism, and may contribute to the normal biology of the prostate cell, as well as prostate cancer progression. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30137 Product name: Recombinant human STEAP4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-110 aa of BC020600 Sequence: MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKI Predict reactive species Full Name: STEAP family member 4 Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC020600 Gene Symbol: STEAP4 Gene ID (NCBI): 79689 RRID: AB_3085176 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q687X5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924