Iright
BRAND / VENDOR: Proteintech

Proteintech, 68469-1-Ig, MIRO2 Monoclonal antibody

CATALOG NUMBER: 68469-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MIRO2 (68469-1-Ig) by Proteintech is a Monoclonal antibody targeting MIRO2 in WB, ELISA applications with reactivity to human samples 68469-1-Ig targets MIRO2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, A549 cells, LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HL-60 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information RHOT2 (Mitochondrial Rho GTPase 2) is also named as MIRO-2, hMiro-2, ARHT2, C16orf39 and Ras homolog gene family member T2. RHOT2 belongs to the mitochondrial Rho GTPase family. RHOT2 gene encodes a member of Rho family of GTPase, which are localized to the outer membrane of mitochondria (PMID: 22078885). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29690 Product name: Recombinant human RHOT2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 388-548 aa of BC014942 Sequence: LCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRL Predict reactive species Full Name: ras homolog gene family, member T2 Calculated Molecular Weight: 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC014942 Gene Symbol: RHOT2 Gene ID (NCBI): 89941 RRID: AB_3085180 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8IXI1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924