Iright
BRAND / VENDOR: Proteintech

Proteintech, 68539-1-Ig, RAD17 Monoclonal antibody

CATALOG NUMBER: 68539-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAD17 (68539-1-Ig) by Proteintech is a Monoclonal antibody targeting RAD17 in WB, ELISA applications with reactivity to Human samples 68539-1-Ig targets RAD17 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, Raji cells, Daudi cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Rad17, a component of the checkpoint clamp loader complex (RAD17/RFC), was originally initially identified as a DNA damage checkpoint protein. Rad17 participates in cell cycle control and DNA damage repair. Rad17 phosphorylation by ATR (ataxia telangiectasia mutated and Rad3-related) kinase is indispensable for the recruitment of Claspin and the activation of Chk1 in response to genotoxic stress. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4348 Product name: Recombinant human RAD17 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 421-670 aa of BC032304 Sequence: LVEPEEVVEMSHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWNTRSLLREYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENCLAAKALFPDFCLPALCRQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEALTDREHGMIDPDSGDEAQLNGGHSAEESLGEPTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT Predict reactive species Full Name: RAD17 homolog (S. pombe) Calculated Molecular Weight: 681 aa, 71 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC032304 Gene Symbol: RAD17 Gene ID (NCBI): 5884 RRID: AB_3085247 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75943 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924