Proteintech, 68561-1-Ig, Integrin alpha-5/CD49e Monoclonal antibody

Size: 20ul / 150ul The Integrin alpha-5/CD49e (68561-1-Ig) by Proteintech is a Monoclonal antibody targeting Integrin alpha-5/CD49e in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68561-1-Ig targets Integrin alpha-5/CD49e in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: A549 cells, HAP1 cells, Jurkat cells, rat colon tissue, HeLa cells, K-562 cells, pig colon tissue, rabbit colon tissue, mouse colon tissue, mouse small intestine tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha 5 (ITGA5), belongs to the integrin alpha chain family, primarily binds to Integrin beta 1 (ITGB1) to form an α5β1 heterodimer (PMID: 33711961). Integrin α5β1 is a specific receptor of fibronectin through its arginine-glycine-aspartic acid (RGD) binding site (PMID: 19608542). Integrin α5β1 plays roles in cell adhesion, migration and matrix formation, and has emerged as an essential mediator in many human carcinomas (PMID: 33408483). Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33642 Product name: Recombinant human Integrin alpha-5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 749-1049 aa of BC008786 Sequence: FTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA Predict reactive species Full Name: integrin, alpha 5 (fibronectin receptor, alpha polypeptide) Calculated Molecular Weight: 115 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC008786 Gene Symbol: Integrin alpha 5 Gene ID (NCBI): 3678 RRID: AB_3085263 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P08648 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.