Iright
BRAND / VENDOR: Proteintech

Proteintech, 68563-1-Ig, TRPV2 Monoclonal antibody

CATALOG NUMBER: 68563-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRPV2 (68563-1-Ig) by Proteintech is a Monoclonal antibody targeting TRPV2 in WB, ELISA applications with reactivity to Human, mouse, rat samples 68563-1-Ig targets TRPV2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, HT-1080 cells, HepG2 cells, K-562 cells, Jurkat cells, Raji cells, TF-1 cells, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8855 Product name: Recombinant human TRPV2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC018926 Sequence: MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCLMKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVKLLVENGANVHARACGRFFQKGQGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQATDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKLAAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCEE Predict reactive species Full Name: transient receptor potential cation channel, subfamily V, member 2 Calculated Molecular Weight: 764 aa, 86 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC018926 Gene Symbol: TRPV2 Gene ID (NCBI): 51393 RRID: AB_3085265 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y5S1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924