Iright
BRAND / VENDOR: Proteintech

Proteintech, 68581-1-Ig, SCNN1A Monoclonal antibody

CATALOG NUMBER: 68581-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SCNN1A (68581-1-Ig) by Proteintech is a Monoclonal antibody targeting SCNN1A in WB, ELISA applications with reactivity to Human samples 68581-1-Ig targets SCNN1A in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A431 cells, HT-1376 cells, LNCaP cells, SK-BR-3 cells, MDA-MB-231 cells, A549 cells, HT-29 cells, SW480 cells, BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29548 Product name: Recombinant human SCNN1A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 363-711 aa of BC006526 Sequence: MPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGRGAQEVASTLASSPPSHFCPHPMSLSLSQPGPAPSPALTAPPPAYATLGPRPSPGGSAGASSSTCPLGGP Predict reactive species Full Name: sodium channel, nonvoltage-gated 1 alpha Calculated Molecular Weight: 76 kDa Observed Molecular Weight: ~80 kDa GenBank Accession Number: BC006526 Gene Symbol: SCNN1A Gene ID (NCBI): 6337 RRID: AB_3085281 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P37088 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924