Iright
BRAND / VENDOR: Proteintech

Proteintech, 68591-1-Ig, RAG1 Monoclonal antibody

CATALOG NUMBER: 68591-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAG1 (68591-1-Ig) by Proteintech is a Monoclonal antibody targeting RAG1 in WB, ELISA applications with reactivity to Human, mouse samples 68591-1-Ig targets RAG1 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: mouse thymus tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Recombination-activating gene (RAG) proteins include RAG1 and RAG2, which are crucial for Ig and T lymphocyte receptor (TCR) fragment rearrangement and are responsible for DNA recognition and cleavage at specific sequences. Mutations in RAG1 result in the complete or partial loss of recombinant enzyme activity, in unbalanced variable-diversity-joining (V(D)J) recombination, and in the impairment of T and B lymphocyte development at the early stages. Specification Tested Reactivity: Human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30192 Product name: Recombinant human RAG1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 878-1043 aa of NM_000448 Sequence: RHEALRELMDLYLKMKPVWRSSCPAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQKFMNAHNALKTSGFTMNPQASLGDPLGIEDSLESQDSMEF Predict reactive species Full Name: recombination activating gene 1 Calculated Molecular Weight: 119 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: NM_000448 Gene Symbol: RAG1 Gene ID (NCBI): 5896 RRID: AB_3085290 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15918 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924