Proteintech, 68593-1-Ig, NGRN Monoclonal antibody

Size: 20ul / 150ul The NGRN (68593-1-Ig) by Proteintech is a Monoclonal antibody targeting NGRN in WB, ELISA applications with reactivity to Human samples 68593-1-Ig targets NGRN in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NGRN, also named as Neugrin or FI58G, is a 291 amino acid protein, which belongs to the neugrin family. NGRN localizes in the nucleus and is expressed at high levels in heart, brain and skeletal muscle. In brain, it is mainly expressed in neurons rather than glial cells. NGRN may be involved in neuronal differentiation. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6790 Product name: Recombinant human NGRN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-219 aa of BC001682 Sequence: MEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVLKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFDSNGNFLYRI Predict reactive species Full Name: neugrin, neurite outgrowth associated Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 30-32 kDa GenBank Accession Number: BC001682 Gene Symbol: NGRN Gene ID (NCBI): 51335 RRID: AB_3085292 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NPE2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.