Proteintech, 68604-1-Ig, RSAD2 Monoclonal antibody

Size: 20ul / 150ul The RSAD2 (68604-1-Ig) by Proteintech is a Monoclonal antibody targeting RSAD2 in WB, ELISA applications with reactivity to Human, mouse, pig samples 68604-1-Ig targets RSAD2 in WB, ELISA applications and shows reactivity with Human, mouse, pig samples. Tested Applications Positive WB detected in: pig liver tissue, mouse liver tissue, mouse brain tissue, pig spleen tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information RSAD2 (radical S-adenosyl methionine domain-containing protein 2), also known as CIG5 (cytomegalovirus-induced gene 5 protein), vig1, viperin or CIG33, displays antiviral effect against HIV-1 virus, hepatitis C virus, human cytomegalovirus, and aphaviruses. Expression of the protein can be induced by interferon. Specification Tested Reactivity: Human, mouse, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27733 Product name: Recombinant human RSAD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 181-361 aa of BC017969 Sequence: DSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW Predict reactive species Full Name: radical S-adenosyl methionine domain containing 2 Calculated Molecular Weight: 361 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC017969 Gene Symbol: RSAD2 Gene ID (NCBI): 91543 RRID: AB_3085300 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8WXG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.