Iright
BRAND / VENDOR: Proteintech

Proteintech, 68618-1-Ig, Angiopoietin 1 Monoclonal antibody

CATALOG NUMBER: 68618-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Angiopoietin 1 (68618-1-Ig) by Proteintech is a Monoclonal antibody targeting Angiopoietin 1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 68618-1-Ig targets Angiopoietin 1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A375 cells, PNGase F treated A375 cells, non-treated U-87 MG cells, PNGase F treated U-87 MG cells, non-treated HuH-7 cells, PNGase F treated HuH-7 MG cells, non-treated bENd.3 cells, PNGase F treated bENd.3 cells Positive IF/ICC detected in: HUVEC cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Angiopoietin 1 is a 70-kDa secreted glycoprotein generated from vascular mural cells, pericytes, and certain other cells. Angiopoietin 1 participates in vascular differentiation through angiogenesis, which is the process of the growth and remodelling of existing vessels. Angiopoietin 1 is also involved in the maintenance and turnover of blood vessels in mature animals. Angiopoietin 1 binds to and activates the TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation, playing an important role in the regulation of angiogenesis. Overexpression of Angiopoietin 1 has been proven to occur in malignant glioblastoma, neuroblastoma, non-small cell lung cancer, and other tumors. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18829 Product name: Recombinant human ANGPT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 161-293 aa of BC152411 Sequence: IQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAG Predict reactive species Full Name: angiopoietin 1 Calculated Molecular Weight: 498 aa, 58 kDa Observed Molecular Weight: 70 kDa, 55 kDa GenBank Accession Number: BC152411 Gene Symbol: Angiopoietin 1 Gene ID (NCBI): 284 RRID: AB_3085311 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q15389 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924