Iright
BRAND / VENDOR: Proteintech

Proteintech, 68635-1-Ig, PTPRH Monoclonal antibody

CATALOG NUMBER: 68635-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PTPRH (68635-1-Ig) by Proteintech is a Monoclonal antibody targeting PTPRH in WB, IF/ICC, ELISA applications with reactivity to human, pig samples 68635-1-Ig targets PTPRH in WB, IF/ICC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig spleen tissue, A431 cells Positive IF/ICC detected in: HT-29 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information PTPRH, also known as SAP-1 (Stomach Cancer-Associated Protein-Tyrosine Phosphatase-1), is a member of the protein tyrosine phosphatase (PTP) family. These enzymes regulate cellular signaling by dephosphorylating tyrosine residues on proteins, counterbalancing kinase activity (PMID: 11278335). PTPRH is classified as a receptor-type PTP, characterized by an extracellular domain, a transmembrane region, and intracellular catalytic domains. In colorectal, gastric, and hepatocellular cancers, PTPRH is often upregulated and linked to poor prognosis (PMID: 12101188). Paradoxically, it may suppress tumorigenesis in other contexts by stabilizing cell adhesion. Overexpression in certain cancers suggests utility as a diagnostic or prognostic marker. The molecular weight of PTPRH is 122 kDa, it is reported that it can form a dimer with a molecular weight of 210 kDa (PMID:15850787). Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17351 Product name: Recombinant human PTPRH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 378-727 aa of BC111716 Sequence: ETRNATTAPNPVRNLHMETQTNSSIALCWEVPDGPYPQDYTYWVEYTGDGGGTETRNTTNTSVTAERLEPGTLYTFSVWAEKNGARGSRQNVSISTVPNAVTSLSKQDWTNSTIALRWTAPQGPGQSSYSYWVSWVREGMTDPRTQSTSGTDITLKELEAGSLYHLTVWAERNEVRGYNSTLTAATAPNEVTDLQNETQTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRTNETWYKVEALEPGTLYNFTVWAERNDVASSTQSLCASTYPDTVTITSCVSTSAGYGVNLIWSCPQGGYEAFELEVGGQRGSQDRSSCGEAVSVLGLGPARSY Predict reactive species Full Name: protein tyrosine phosphatase, receptor type, H Calculated Molecular Weight: 1115 aa, 122 kDa Observed Molecular Weight: 200-210 kDa GenBank Accession Number: BC111716 Gene Symbol: PTPRH Gene ID (NCBI): 5794 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9HD43 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924