Iright
BRAND / VENDOR: Proteintech

Proteintech, 68654-1-Ig, RS1 Monoclonal antibody

CATALOG NUMBER: 68654-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RS1 (68654-1-Ig) by Proteintech is a Monoclonal antibody targeting RS1 in WB, ELISA applications with reactivity to Human, rat, mouse, rabbit samples 68654-1-Ig targets RS1 in WB, ELISA applications and shows reactivity with Human, rat, mouse, rabbit samples. Tested Applications Positive WB detected in: rabbit retina tissue, mouse retina tissue, rat retina tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information RS1 is also named as XLRS1. RS1 can bind negatively charged membrane lipids, such as phosphatidylserine and phosphoinositides. RS1 is required for normal structure and function of the retina (PMID:19093009). It may play a role in cell-cell adhesion processes in the retina (PMID:27114531). RS1 is high expression in the retina (at protein level) (PMID:10915776, PMID:9326935). It is detected in the inner segment of the photoreceptors, the inner nuclear layer, the inner plexiform layer and the ganglion cell layer. At the macula, it is expressed in both the outer and inner nuclear layers and in the inner plexiform layer (PMID:10915776, PMID:10915776). And RS1 is undetectable in the inner plexiform layers and the inner nuclear layer (PMID:10915776) Specification Tested Reactivity: Human, rat, mouse, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18885 Product name: Recombinant human RS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-224 aa of BC141638 Sequence: TEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA Predict reactive species Full Name: retinoschisin 1 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC141638 Gene Symbol: RS1 Gene ID (NCBI): 6247 RRID: AB_3670396 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O15537 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924