Iright
BRAND / VENDOR: Proteintech

Proteintech, 68713-1-Ig, MTF2 Monoclonal antibody

CATALOG NUMBER: 68713-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MTF2 (68713-1-Ig) by Proteintech is a Monoclonal antibody targeting MTF2 in WB, ELISA applications with reactivity to Human, Rat, Rabbit, Mouse samples 68713-1-Ig targets MTF2 in WB, ELISA applications and shows reactivity with Human, Rat, Rabbit, Mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, Rabbit testis tissue, Mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information MTF2, also named as Metal-response element-binding transcription factor 2, is a 593 amino acid protein. It exists several isoforms and the range of the molecular weight of isoforms are about 55-60 kDa and 29 kDa. MTF2 contains 2 PHD-type zinc fingers and belongs to the Polycomblike family. MTF2 acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting the PRC2 complex, leading to enhance PRC2 H3K27me3 methylation activity and regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation. Specification Tested Reactivity: Human, Rat, Rabbit, Mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9384 Product name: Recombinant human MTF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 187-536 aa of BC010013 Sequence: ADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMEVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS Predict reactive species Full Name: metal response element binding transcription factor 2 Calculated Molecular Weight: 536 aa, 61 kDa Observed Molecular Weight: 55 kDa, 60 kDa, 75 kDa GenBank Accession Number: BC010013 Gene Symbol: MTF2 Gene ID (NCBI): 22823 RRID: AB_3670406 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y483 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924