Proteintech, 68716-1-Ig, SPDEF Monoclonal antibody

Size: 20ul / 150ul The SPDEF (68716-1-Ig) by Proteintech is a Monoclonal antibody targeting SPDEF in WB, ELISA applications with reactivity to Human samples 68716-1-Ig targets SPDEF in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: EC109 cells, A549 cells, HeLa cells, MCF-7 cells, LNCaP cells, PC-3 cells, DU 145 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33739 Product name: Recombinant human SPDEF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-335 aa of BC021299 Sequence: MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI Predict reactive species Full Name: SAM pointed domain containing ets transcription factor Calculated Molecular Weight: 335 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC021299 Gene Symbol: SPDEF Gene ID (NCBI): 25803 RRID: AB_3670409 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O95238 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.