Proteintech, 68722-2-Ig, EMC7/C15orf24 Monoclonal antibody

Size: 20ul / 150ul The EMC7/C15orf24 (68722-2-Ig) by Proteintech is a Monoclonal antibody targeting EMC7/C15orf24 in WB, ELISA applications with reactivity to Human, Mouse , Rat samples 68722-2-Ig targets EMC7/C15orf24 in WB, ELISA applications and shows reactivity with Human, Mouse , Rat samples. Tested Applications Positive WB detected in: HSC-T6 cells, LNCaP cells, MCF-7 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, U2OS cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The mammalian ER membrane complex (EMC) is composed of 10 subunits, EMC 1-10. Endoplasmic reticulum membrane protein complex subunit 7(EMC7, also named C15orf24) is part of the endoplasmic reticulum membrane protein complex (EMC) that enables theenergy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. Specification Tested Reactivity: Human, Mouse , Rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26813 Product name: Recombinant human C15orf24 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-159 aa of BC104934 Sequence: SEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD Predict reactive species Full Name: chromosome 15 open reading frame 24 Observed Molecular Weight: 20-26 kDa GenBank Accession Number: BC104934 Gene Symbol: EMC7 Gene ID (NCBI): 56851 RRID: AB_3670415 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NPA0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.