Proteintech, 68723-1-Ig, TREM2 Monoclonal antibody

Size: 20ul / 150ul The TREM2 (68723-1-Ig) by Proteintech is a Monoclonal antibody targeting TREM2 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 68723-1-Ig targets TREM2 in WB, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: THP-1 cells Positive IF-P detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information TREM2 (triggering receptor expressed on myeloid cells 2) is a cell surface receptor belongs to TREM family that is expressed on osteoclast, dendritic cells, macrophages, nature killers, neutrophils and microglia (PMID: 19302484). TREM2 is localized predominantly in the Golgi complex, but also shuttles to and from the cell surface in endocytic and exocytic vesicles (PMID: 16675145). TREM2 associates with DAP12 to initiate the intracellular signalling cascade via an immunoreceptor tyrosine-based activation motif (ITAM) domain and tyrosine-kinases (PMID: 23977213). TREM2 has a calculated molecular mass of ~25kDa, but apparent molecular mass of ~40kDa (PMID: 24078628). In addition, TREM2 has a soluble form termed as sTREM-2 with molecular weights ranging between about 24kDa and 40kDa (PMID: 18790823). Loss-of-function mutations in either TREM2 or DAP12 can cause Nasu-Hakola disease (PMID: 19302484). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6843 Product name: Recombinant human TREM2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-222 aa of BC032362 Sequence: TVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRPSQGSHLPSCLSKEPLGRRNPLPTHFHPSPPGLHLSHQDSSSQRPLGCSLAWTEARDTSTQ Predict reactive species Full Name: triggering receptor expressed on myeloid cells 2 Calculated Molecular Weight: 222 aa, 25 kDa Observed Molecular Weight: 26-32 kDa GenBank Accession Number: BC032362 Gene Symbol: TREM2 Gene ID (NCBI): 54209 RRID: AB_3206275 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NZC2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.