Proteintech, 68810-1-Ig, DNA ligase III/LIG3 Monoclonal antibody

Size: 20ul / 150ul The DNA ligase III/LIG3 (68810-1-Ig) by Proteintech is a Monoclonal antibody targeting DNA ligase III/LIG3 in WB, ELISA applications with reactivity to human, mouse, rat samples 68810-1-Ig targets DNA ligase III/LIG3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HSC-T6 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information DNA ligase III (DNA ligase 3) is an enzyme that in humans is encoded by the LIG3 gene. The human LIG3 gene encodes ATP-dependent DNA ligases that seal interruptions in the phosphodiester backbone of duplex DNA. There are three families of ATP-dependent DNA ligases in eukaryotes. These enzymes utilize the same three step reaction mechanism; 1 formation of a covalent enzyme-adenylate intermediate; 2 transfer of the adenylate group to the 5' phosphate terminus of a DNA nick; 3 phosphodiester bond formation. Unlike LIG1 and LIG4 family members that are found in almost all eukaryotes, LIG3 family members are less widely distributed. The LIG3 gene encodes several distinct DNA ligase species by alternative translation initiation and alternative splicing mechanisms. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31484 Product name: Recombinant human LIG3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 254-390 aa of BC068005 Sequence: CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKE Predict reactive species Full Name: ligase III, DNA, ATP-dependent Calculated Molecular Weight: 100-110 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC068005 Gene Symbol: LIG3 Gene ID (NCBI): 3980 RRID: AB_3670431 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P49916 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.