Iright
BRAND / VENDOR: Proteintech

Proteintech, 68812-3-Ig, THOC3 Monoclonal antibody

CATALOG NUMBER: 68812-3-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The THOC3 (68812-3-Ig) by Proteintech is a Monoclonal antibody targeting THOC3 in WB, IF/ICC, ELISA applications with reactivity to human samples 68812-3-Ig targets THOC3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-10A cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information THOC3 is a component of the nuclear THO transcription elongation complex, which is a part of the larger transcription export (TREX) complex that couples messenger RNA processing and export. Additionally, THOC3 plays a key role in many cellular mechanisms, such as in the pathogenesis of cancer and neurodegenerative diseases (PMID: 36674977). THOC3 has 2 isoforms with the molecular weights of 36 kDa and 39 kDa. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag35578 Product name: Recombinant human THOC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-348 aa of BC006849 Sequence: MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQELFRGHSKTREFLAHSAKVHSVAWSCDGRRLASGSFDKTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASGDKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLTNGNGCINILSYPELKPVQSINAHPSNCICIKFDPMGKYFATGSADALVSLWDVDELVCVRCFSRLDWPVRTLSFSHDGKMLASASEDHFIDIAEVETGDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLP Predict reactive species Full Name: THO complex 3 Calculated Molecular Weight: 327 aa, 36 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC006849 Gene Symbol: THOC3 Gene ID (NCBI): 84321 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96J01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924