Proteintech, 68815-3-Ig, CPT2 Monoclonal antibody

Size: 20ul / 150ul The CPT2 (68815-3-Ig) by Proteintech is a Monoclonal antibody targeting CPT2 in WB, ELISA applications with reactivity to human, rat samples 68815-3-Ig targets CPT2 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, LNCaP cells, rat liver tissue, HepG2 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Carnitine palmitoyltransferase-1 and -2 (CPT1 and CPT2) are two genetically distinct mitochondrial membrane bound enzymes and play critical role in the regulation of FAO in normal cells. CPT2 is an ubiquitous protein and locates in the inner membrane of mitochondrial (PMID: 29437870). CPT2 is frequently down-regulated in primary ovarian serous carcinomas, which is significantly correlated with poor survival of ovarian cancer patients (PMID: 33486313). Down-regulation of CPT2 was a major cause of acylcarnitine accumulation and a common feature in mouse models of obesity- and NASH-driven HCC and human SH-HCC (PMID: 29872321). Specification Tested Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24833 Product name: Recombinant human CPT2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 32-178 aa of BC002445 Sequence: GQYLQRSIVPTMHYQDSLPRLPIPKLEDTIRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYILGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHL Predict reactive species Full Name: carnitine palmitoyltransferase 2 Calculated Molecular Weight: 74 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC002445 Gene Symbol: CPT2 Gene ID (NCBI): 1376 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P23786 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.