Iright
BRAND / VENDOR: Proteintech

Proteintech, 68824-1-Ig, EIF2B1 Monoclonal antibody

CATALOG NUMBER: 68824-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EIF2B1 (68824-1-Ig) by Proteintech is a Monoclonal antibody targeting EIF2B1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, pig samples 68824-1-Ig targets EIF2B1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: NIH/3T3 cells, U2OS cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human, mouse, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12493 Product name: Recombinant human EIF2B1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-305 aa of BC103763 Sequence: MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL Predict reactive species Full Name: eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa Calculated Molecular Weight: 305 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC103763 Gene Symbol: EIF2B1 Gene ID (NCBI): 1967 RRID: AB_3670435 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14232 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924