Iright
BRAND / VENDOR: Proteintech

Proteintech, 68969-4-Ig, Claudin 1 Monoclonal antibody

CATALOG NUMBER: 68969-4-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Claudin 1 (68969-4-Ig) by Proteintech is a Monoclonal antibody targeting Claudin 1 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 68969-4-Ig targets Claudin 1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: ACHN cells, pig skin tissue, Caki-1 cells, HaCaT cells, HepG2 cells, HT-1376 cells, rat skin tissue, mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 23 claudins have been identified. They are small (20-27 kilodalton (kDa)) proteins with similar structures. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Claudin-1 is an integral membrane protein expressed primarily in keratinocytes and normal mammary epithelial cells. Claudin 1 forms tight junctions with other claudin proteins and plays an important role in the intestinal epithelial barrier. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29478 Product name: Recombinant human Claudin 1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 102-211 aa of BC012471 Sequence: MKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV Predict reactive species Full Name: claudin 1 Calculated Molecular Weight: 211 aa, 23 kDa Observed Molecular Weight: 20-23 kDa GenBank Accession Number: BC012471 Gene Symbol: Claudin 1 Gene ID (NCBI): 9076 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O95832 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924