Iright
BRAND / VENDOR: Proteintech

Proteintech, 68981-3-Ig, LAPTM4B Monoclonal antibody

CATALOG NUMBER: 68981-3-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LAPTM4B (68981-3-Ig) by Proteintech is a Monoclonal antibody targeting LAPTM4B in WB, ELISA applications with reactivity to human samples 68981-3-Ig targets LAPTM4B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: TT cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information LAPTM4B, a novel oncoprotein, is associated with the prognosis of cancer, and may play important roles in the initiation, promotion and metastasis of tumors. It was initially identified as a hepatocellular carcinoma-associated gene, and was recently shown to be up-regulated in various human cancers. Some studies indicated that LAPTM4B may be an useful marker of prognosis in ovarian carcinoma and endometrial cancer. LAPTM4B belongs to the LAPTM4/LAPTM5 transporter family. It has 3 isoforms with molecular masses 41 kDa, 35 kDa and 24 kDa. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag38696 Product name: Recombinant human LAPTM4B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-139 aa of BC014129 Sequence: MKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADPDQYNFSSSELGGDFEFMDDANMCIAIAISLLMILICAMATYGAYKQRAAWIIPFFCYQIFDFALNMLVAITVLIYPNSIQEYIRQLPPN Predict reactive species Full Name: lysosomal protein transmembrane 4 beta Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC014129 Gene Symbol: LAPTM4B Gene ID (NCBI): 55353 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q86VI4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924