Iright
BRAND / VENDOR: Proteintech

Proteintech, 68995-1-Ig, HJURP Monoclonal antibody

CATALOG NUMBER: 68995-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HJURP (68995-1-Ig) by Proteintech is a Monoclonal antibody targeting HJURP in WB, IF/ICC, ELISA applications with reactivity to human samples 68995-1-Ig targets HJURP in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PANC-1 cells, SW 1990 cells, Saos2 cells, U2OS cells, A549 cells, HeLa cells, MDA-MB-468 cells, Jurkat cells, K-562 cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Holliday Junction Recognition Protein (HJURP, also known as hFLEG1) is a centromeric protein with a pivotal role in the incorporation and maintenance of histone H3-like variant Centromere Protein-A (CENP-A) in centromeres. It is a specific chaperone for CENP-A and it integrates newly synthesized CENP-A molecules and nucleosomes at replicated centromeres. (PMID: 28819432, PMID: 31492860) Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag34571 Product name: Recombinant human HJURP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 394-748 aa of BC001940 Sequence: ATYNLDEENRFRTLKWLISPVKIVSRPTIRQGHGENRQREIEIRFDQLHREYCLSPRNQPRRMCLPDSWAMNMYRGGPASPGGLQGLETRRLSLPSSKAKAKSLSEAFENLGKRSLEAGRCLPKSDSSSSLPKTNPTHSATRPQQTSDLHVQGNSSGIFRKSVSPSKTLSVPDKEVPGHGRNRYDEIKEEFDKLHQKYCLKSPGQMTVPLCIGVSTDKASMEVRYQTEGFLGKLNPDPHFQGFQKLPSSPLGCRKSLLGSTAIEAPSSTCVARAITRDGTRDHQFPAKRPRLSEPQGSGRQGNSLGASDGVDNTVRPGDQGSSSQPNSEERGENTSYRMEEKSDFMLEKLETKSV Predict reactive species Full Name: Holliday junction recognition protein Calculated Molecular Weight: 86 kDa Observed Molecular Weight: 85-90 kDa GenBank Accession Number: BC001940 Gene Symbol: HJURP Gene ID (NCBI): 55355 RRID: AB_3670458 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8NCD3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924